SCOPe 2.07: Domain d3pnzc_: 3pnz C:

Lineage for d3pnzc_ (3pnz C:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.0: automated matches [191327] (1 protein)
   not a true family

6. Protein automated matches [190150] (34 species)
   not a true protein

7. Species Listeria monocytogenes [TaxId:267410] [189815] (1 PDB entry)

8. Domain d3pnzc_: 3pnz C: [183902]
   automated match to d1bf6a_
   complexed with gol, po4, zn

Details for d3pnzc_

PDB Entry: 3pnz, 1.6 Å

PDB Description: Crystal structure of the lactonase Lmo2620 from Listeria monocytogenes

PDB Compounds: (C:) Phosphotriesterase family protein

SCOPe Domain Sequences for d3pnzc_:

Sequence; same for both SEQRES and ATOM records:

>d3pnzc_ c.1.9.0 (C:) automated matches {Listeria monocytogenes [TaxId: 267410]}
sfirtfygdiapeqlgftyshehivcvpaywqerdaddlllddkeksqldvqdfadlggk
tivdatavdygrrvldvaqisketgiqivgtagfnksflwdgkikpelkpiigdfetyye
wientttdkltefvvnevenglegtpykagqvkfgtgynmitpleektiravarahhetk
apihshteagtmaleqieilkqenipleylsighmdrnldpyyhkqvaktgafmsfdgia
kikyapesariaailylvsegfedqilvsgdtarktyykhyghgpgleyiakkwvprfid
eanekgfdgeklvkkffvdnparcftfk

Timeline for d3pnzc_:

• d3pnzc_ first appeared in SCOPe 2.01
  
• d3pnzc_ appears in SCOPe 2.06
  
• d3pnzc_ appears in the current release, SCOPe 2.08