Lineage for d3pjbb_ (3pjb B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1643322Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1643323Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1643324Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1643577Protein automated matches [190406] (14 species)
    not a true protein
  7. 1643827Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [188538] (21 PDB entries)
  8. 1643847Domain d3pjbb_: 3pjb B: [183797]
    automated match to d1uisa_
    complexed with gol

Details for d3pjbb_

PDB Entry: 3pjb (more details), 1.75 Å

PDB Description: crystal structure of red fluorescent protein eqfp578 crystallized at ph 4.0
PDB Compounds: (B:) Red fluorescent protein eqFP578

SCOPe Domain Sequences for d3pjbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pjbb_ d.22.1.1 (B:) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]}
selikenmhmklymegtvnnhhfkctsegegkpyegtqtmkikvveggplpfafdilats
fmygsktfinhtqgipdffkqsfpegftwerittyedggvltatqdtslqngciiynvki
ngvnfpsngsvmqkktlgweantemlypadgglrghsqmalklvgggylhcsfkttyrsk
kpaknlkmpgfhfvdhrlerikeadketyveqhemavakycdlps

SCOPe Domain Coordinates for d3pjbb_:

Click to download the PDB-style file with coordinates for d3pjbb_.
(The format of our PDB-style files is described here.)

Timeline for d3pjbb_: