Lineage for d3pj9b_ (3pj9 B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1415050Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 1415051Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 1415295Protein automated matches [190032] (11 species)
    not a true protein
  7. 1415404Species Campylobacter jejuni [TaxId:192222] [189538] (1 PDB entry)
  8. 1415406Domain d3pj9b_: 3pj9 B: [183793]
    automated match to d1nhkr_
    complexed with so4

Details for d3pj9b_

PDB Entry: 3pj9 (more details), 2.1 Å

PDB Description: crystal structure of a nucleoside diphosphate kinase from campylobacter jejuni
PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3pj9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pj9b_ d.58.6.1 (B:) automated matches {Campylobacter jejuni [TaxId: 192222]}
mektlsiikpdavkkgvigkildrfesnglriaamkkvqlskeqaenfyavhkerpffkd
lvefmisgpvvvsilegegavlknrdlmgatnpkeakagtiradfaesidanavhgsdsl
enakieiefffkpneic

SCOPe Domain Coordinates for d3pj9b_:

Click to download the PDB-style file with coordinates for d3pj9b_.
(The format of our PDB-style files is described here.)

Timeline for d3pj9b_: