PDB entry 3pj9

View 3pj9 on RCSB PDB site
Description: Crystal structure of a Nucleoside Diphosphate Kinase from Campylobacter jejuni
Class: transferase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, Nucleoside Diphosphate Kinase, Ndk, Campylobacter jejuni subsp. jejuni NCTC 11168, TRANSFERASE
Deposited on 2010-11-09, released 2010-11-24
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.171
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Campylobacter jejuni subsp. jejuni [TaxId:192222]
    Gene: Cj0332c, ndk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3pj9a_
  • Chain 'B':
    Compound: Nucleoside diphosphate kinase
    Species: Campylobacter jejuni subsp. jejuni [TaxId:192222]
    Gene: Cj0332c, ndk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3pj9b_
  • Chain 'C':
    Compound: Nucleoside diphosphate kinase
    Species: Campylobacter jejuni subsp. jejuni [TaxId:192222]
    Gene: Cj0332c, ndk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3pj9c_
  • Chain 'D':
    Compound: Nucleoside diphosphate kinase
    Species: Campylobacter jejuni subsp. jejuni [TaxId:192222]
    Gene: Cj0332c, ndk
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PIG7 (3-139)
      • expression tag (1-2)
    Domains in SCOPe 2.03: d3pj9d_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pj9A (A:)
    nsamektlsiikpdavkkgvigkildrfesnglriaamkkvqlskeqaenfyavhkerpf
    fkdlvefmisgpvvvsilegegavlknrdlmgatnpkeakagtiradfaesidanavhgs
    dslenakieiefffkpneic
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pj9A (A:)
    mektlsiikpdavkkgvigkildrfesnglriaamkkvqlskeqaenfyavhkerpffkd
    lvefmisgpvvvsilegegavlknrdlmgatnpkeakagtiradfaesidanavhgsdsl
    enakieiefffkpneic
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pj9B (B:)
    nsamektlsiikpdavkkgvigkildrfesnglriaamkkvqlskeqaenfyavhkerpf
    fkdlvefmisgpvvvsilegegavlknrdlmgatnpkeakagtiradfaesidanavhgs
    dslenakieiefffkpneic
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pj9B (B:)
    mektlsiikpdavkkgvigkildrfesnglriaamkkvqlskeqaenfyavhkerpffkd
    lvefmisgpvvvsilegegavlknrdlmgatnpkeakagtiradfaesidanavhgsdsl
    enakieiefffkpneic
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3pj9C (C:)
    nsamektlsiikpdavkkgvigkildrfesnglriaamkkvqlskeqaenfyavhkerpf
    fkdlvefmisgpvvvsilegegavlknrdlmgatnpkeakagtiradfaesidanavhgs
    dslenakieiefffkpneic
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pj9C (C:)
    mektlsiikpdavkkgvigkildrfesnglriaamkkvqlskeqaenfyavhkrpffkdl
    vefmisgpvvvsilegegavlknrdlmgatnpkeakagtiradfaesidanavhgsdsle
    nakieiefffkpneic
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3pj9D (D:)
    nsamektlsiikpdavkkgvigkildrfesnglriaamkkvqlskeqaenfyavhkerpf
    fkdlvefmisgpvvvsilegegavlknrdlmgatnpkeakagtiradfaesidanavhgs
    dslenakieiefffkpneic
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pj9D (D:)
    samektlsiikpdavkkgvigkildrfesnglriaamkkvqlskeqaenfyavhkerpff
    kdlvefmisgpvvvsilegegavlknrdlmgatnpkeakagtiradfaesidanavhgsd
    slenakieiefffkpneic