SCOPe 2.04: Domain d3pj7a_: 3pj7 A:

Lineage for d3pj7a_ (3pj7 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (14 species)
   not a true protein

7. Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [188538] (21 PDB entries)

8. Domain d3pj7a_: 3pj7 A: [183787]
   automated match to d1uisa_

Details for d3pj7a_

PDB Entry: 3pj7, 1.85 Å

PDB Description: Crystal structure of far-red fluorescent protein Katushka crystallized at pH 8.5

PDB Compounds: (A:) Red fluorescent protein eqFP578

SCOPe Domain Sequences for d3pj7a_:

Sequence; same for both SEQRES and ATOM records:

>d3pj7a_ d.22.1.1 (A:) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]}
elisenmhmklymegtvndhhfkctsegegkpyegtqtmkikvveggplpfafdilatsf
mygsktfinhtqgipdffkqsfpegftwerittyedggvltatqdtslqngcliynvkin
gvnfpsngpvmqkktlgweastemlypadsglrghsqmalklvgggylhcslkttyrskk
paknlkmpgfyfvdrklerikeadketyveqhemavarycdlpsk

Timeline for d3pj7a_:

• d3pj7a_ first appeared in SCOPe 2.01
  
• d3pj7a_ appears in SCOPe 2.03
  
• d3pj7a_ appears in SCOPe 2.05
  
• d3pj7a_ appears in the current release, SCOPe 2.08