SCOP 1.75: Domain d1g3ng2: 1g3n G:148-253

Lineage for d1g3ng2 (1g3n G:148-253)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (8 proteins)

6. Protein Viral cyclin [47961] (3 species)

7. Species Kaposi's sarcoma-associated herpesvirus [TaxId:37296] [47964] (1 PDB entry)

8. Domain d1g3ng2: 1g3n G:148-253 [18369]
   Other proteins in same PDB: d1g3na_, d1g3nb_, d1g3ne_, d1g3nf_

Details for d1g3ng2

PDB Entry: 1g3n, 2.9 Å

PDB Description: structure of a p18(ink4c)-cdk6-k-cyclin ternary complex

PDB Compounds: (G:) v-cyclin

SCOP Domain Sequences for d1g3ng2:

Sequence, based on SEQRES records:

>d1g3ng2 a.74.1.1 (G:148-253) Viral cyclin {Kaposi's sarcoma-associated herpesvirus [TaxId: 37296]}
avlatdvtsflllklvggsqhldfwhhevntlitkalvdpltgslpasiisaagcallvp
anvipqdthsggvvpqlasilgcdvsvlqaaveqiltsvsdfdlri

Sequence, based on observed residues (ATOM records):

>d1g3ng2 a.74.1.1 (G:148-253) Viral cyclin {Kaposi's sarcoma-associated herpesvirus [TaxId: 37296]}
avlatdvtsflllklvggsqhldfwhhevntlitkalvdpltgslpasiisaagcallvp
anvipqgvvpqlasilgcdvsvlqaaveqiltsvsdfdlri

Timeline for d1g3ng2:

• d1g3ng2 first appeared (with stable ids) in SCOP 1.55
  
• d1g3ng2 appears in SCOP 1.73
  
• d1g3ng2 appears in SCOPe 2.01
  
• d1g3ng2 appears in the current release, SCOPe 2.08