Lineage for d1g3ng2 (1g3n G:148-253)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718077Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2718531Protein Viral cyclin [47961] (3 species)
  7. 2718547Species Kaposi's sarcoma-associated herpesvirus [TaxId:37296] [47964] (1 PDB entry)
  8. 2718551Domain d1g3ng2: 1g3n G:148-253 [18369]
    Other proteins in same PDB: d1g3na_, d1g3nb_, d1g3ne_, d1g3nf_

Details for d1g3ng2

PDB Entry: 1g3n (more details), 2.9 Å

PDB Description: structure of a p18(ink4c)-cdk6-k-cyclin ternary complex
PDB Compounds: (G:) v-cyclin

SCOPe Domain Sequences for d1g3ng2:

Sequence, based on SEQRES records: (download)

>d1g3ng2 a.74.1.1 (G:148-253) Viral cyclin {Kaposi's sarcoma-associated herpesvirus [TaxId: 37296]}
avlatdvtsflllklvggsqhldfwhhevntlitkalvdpltgslpasiisaagcallvp
anvipqdthsggvvpqlasilgcdvsvlqaaveqiltsvsdfdlri

Sequence, based on observed residues (ATOM records): (download)

>d1g3ng2 a.74.1.1 (G:148-253) Viral cyclin {Kaposi's sarcoma-associated herpesvirus [TaxId: 37296]}
avlatdvtsflllklvggsqhldfwhhevntlitkalvdpltgslpasiisaagcallvp
anvipqgvvpqlasilgcdvsvlqaaveqiltsvsdfdlri

SCOPe Domain Coordinates for d1g3ng2:

Click to download the PDB-style file with coordinates for d1g3ng2.
(The format of our PDB-style files is described here.)

Timeline for d1g3ng2: