Lineage for d1g3ng2 (1g3n G:148-253)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 283121Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 283122Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 283123Family a.74.1.1: Cyclin [47955] (4 proteins)
  6. 283209Protein Viral cyclin [47961] (3 species)
  7. 283215Species Kaposi's sarcoma-associated virus [47964] (1 PDB entry)
  8. 283219Domain d1g3ng2: 1g3n G:148-253 [18369]
    Other proteins in same PDB: d1g3na_, d1g3nb_, d1g3ne_, d1g3nf_

Details for d1g3ng2

PDB Entry: 1g3n (more details), 2.9 Å

PDB Description: structure of a p18(ink4c)-cdk6-k-cyclin ternary complex

SCOP Domain Sequences for d1g3ng2:

Sequence, based on SEQRES records: (download)

>d1g3ng2 a.74.1.1 (G:148-253) Viral cyclin {Kaposi's sarcoma-associated virus}
avlatdvtsflllklvggsqhldfwhhevntlitkalvdpltgslpasiisaagcallvp
anvipqdthsggvvpqlasilgcdvsvlqaaveqiltsvsdfdlri

Sequence, based on observed residues (ATOM records): (download)

>d1g3ng2 a.74.1.1 (G:148-253) Viral cyclin {Kaposi's sarcoma-associated virus}
avlatdvtsflllklvggsqhldfwhhevntlitkalvdpltgslpasiisaagcallvp
anvipqgvvpqlasilgcdvsvlqaaveqiltsvsdfdlri

SCOP Domain Coordinates for d1g3ng2:

Click to download the PDB-style file with coordinates for d1g3ng2.
(The format of our PDB-style files is described here.)

Timeline for d1g3ng2: