SCOPe 2.01: Domain d3pb0c_: 3pb0 C:

Lineage for d3pb0c_ (3pb0 C:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein automated matches [190095] (14 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [186818] (3 PDB entries)

8. Domain d3pb0c_: 3pb0 C: [183619]
   automated match to d1o5ka_
   complexed with so4

Details for d3pb0c_

PDB Entry: 3pb0, 2 Å

PDB Description: Characterisation of the first monomeric dihydrodipicolinate synthase variant reveals evolutionary insights

PDB Compounds: (C:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3pb0c_:

Sequence; same for both SEQRES and ATOM records:

>d3pb0c_ c.1.10.1 (C:) automated matches {Thermotoga maritima [TaxId: 2336]}
gidpftmfrgvgtaivtpfkngeldlesyerlvryqlengvnalivlgttgesptvnede
reklvsrtleivdgkipvivgagtnstektlklvkqaeklgangvlvvtpyynkptqegl
yqhykyisertdlgivvynvpgrtgvnvlpetaariaadlknvvgikeanpaaaqidrtv
sltkqarsdfmvwsgnddrtfyllcaggdgvisvvsnvapkqmvelcaeyfsgnleksre
vhrklrplmkalfvetnpipvkaalnlmgfienelrlplvpasektvellrnvlkesgll

Timeline for d3pb0c_:

• d3pb0c_ is new in SCOPe 2.01-stable
  
• d3pb0c_ appears in SCOPe 2.02
  
• d3pb0c_ appears in the current release, SCOPe 2.08, called d3pb0c1