Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) |
Protein Pentaerythritol tetranirate reductase [63900] (1 species) |
Species Enterobacter cloacae [TaxId:550] [63901] (33 PDB entries) Uniprot P71278 |
Domain d3p8ia_: 3p8i A: [183588] automated match to d1gvra_ complexed with act, fmn; mutant has additional insertions and/or extensions that are not grouped together |
PDB Entry: 3p8i (more details), 1.19 Å
SCOPe Domain Sequences for d3p8ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p8ia_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} eklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatqis aqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapvsa salnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvelhs ahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtfqn vdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviigaga ytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesffgggaegytdyp sl
Timeline for d3p8ia_: