Lineage for d3p6ua_ (3p6u A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1094812Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1094813Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1094814Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 1094979Protein Cytochrome P450-CAM [48266] (1 species)
  7. 1094980Species Pseudomonas putida [TaxId:303] [48267] (94 PDB entries)
    Uniprot P00183
  8. 1095014Domain d3p6ua_: 3p6u A: [183564]
    automated match to d1t87a_
    complexed with hem

Details for d3p6ua_

PDB Entry: 3p6u (more details), 1.7 Å

PDB Description: crystal structure of cytochrome p450cam crystallized in the presence of a tethered substrate analog adac3-c6-dans
PDB Compounds: (A:) Camphor 5-monooxygenase

SCOPe Domain Sequences for d3p6ua_:

Sequence, based on SEQRES records: (download)

>d3p6ua_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

Sequence, based on observed residues (ATOM records): (download)

>d3p6ua_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreaydfiptsmdppeqrqfralanqvvgmpvvdklenriq
elacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgsmt
faeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggldt
vvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhgvql
kkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiivtlk
ewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOPe Domain Coordinates for d3p6ua_:

Click to download the PDB-style file with coordinates for d3p6ua_.
(The format of our PDB-style files is described here.)

Timeline for d3p6ua_: