Lineage for d1fvvd1 (1fvv D:173-309)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 918296Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 918297Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 918298Family a.74.1.1: Cyclin [47955] (8 proteins)
  6. 918311Protein Cyclin A [47956] (2 species)
  7. 918411Species Human (Homo sapiens) [TaxId:9606] [47957] (35 PDB entries)
    Uniprot P20248 175-432
  8. 918536Domain d1fvvd1: 1fvv D:173-309 [18352]
    Other proteins in same PDB: d1fvva_, d1fvvc_
    complexed with 107

Details for d1fvvd1

PDB Entry: 1fvv (more details), 2.8 Å

PDB Description: the structure of cdk2/cyclin a in complex with an oxindole inhibitor
PDB Compounds: (D:) cyclin a

SCOPe Domain Sequences for d1fvvd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fvvd1 a.74.1.1 (D:173-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
nevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetl
hlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvl
rmehlvlkvltfdlaap

SCOPe Domain Coordinates for d1fvvd1:

Click to download the PDB-style file with coordinates for d1fvvd1.
(The format of our PDB-style files is described here.)

Timeline for d1fvvd1: