SCOPe 2.06: Domain d3p38a_: 3p38 A:

Lineage for d3p38a_ (3p38 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.299: Ns1 effector domain-like [143020] (1 superfamily)
   beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7]

4. Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family)
   automatically mapped to Pfam PF00600

5. Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins)
   C-terminal part of Pfam PF00600

6. Protein automated matches [190936] (6 species)
   not a true protein

7. Species Influenza A virus [TaxId:680789] [189731] (3 PDB entries)

8. Domain d3p38a_: 3p38 A: [183483]
   automated match to d2gx9a1
   mutant

Details for d3p38a_

PDB Entry: 3p38, 2.76 Å

PDB Description: Crystal structure of the NS1 effector domain W182A mutant from influenza A/Vietnam/1203/2004 (H5N1) virus

PDB Compounds: (A:) nonstructural protein 1

SCOPe Domain Sequences for d3p38a_:

Sequence; same for both SEQRES and ATOM records:

>d3p38a_ d.299.1.1 (A:) automated matches {Influenza A virus [TaxId: 680789]}
kmpasryltdmtleemsrdwfmlmpkqkvagslcikmdqaimdktiilkanfsvifdrle
tlillrafteegaivgeisplpslpghtgedvknaigvliggleandntvrvtetiqrfa
wrn

Timeline for d3p38a_:

• d3p38a_ first appeared in SCOPe 2.01
  
• d3p38a_ appears in SCOPe 2.05
  
• d3p38a_ appears in SCOPe 2.07
  
• d3p38a_ appears in the current release, SCOPe 2.08