SCOPe 2.08: Domain d1jstd1: 1jst D:175-309

Lineage for d1jstd1 (1jst D:175-309)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries)
   Uniprot P20248 175-432

8. Domain d1jstd1: 1jst D:175-309 [18348]
   Other proteins in same PDB: d1jsta_, d1jstc_
   complexed with atp, mn

Details for d1jstd1

PDB Entry: 1jst, 2.6 Å

PDB Description: phosphorylated cyclin-dependent kinase-2 bound to cyclin a

PDB Compounds: (D:) cyclin a

SCOPe Domain Sequences for d1jstd1:

Sequence; same for both SEQRES and ATOM records:

>d1jstd1 a.74.1.1 (D:175-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaap

Timeline for d1jstd1:

• d1jstd1 first appeared (with stable ids) in SCOP 1.55
  
• d1jstd1 appears in SCOPe 2.07