Lineage for d3p2lc_ (3p2l C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2460578Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2460794Protein automated matches [190149] (15 species)
    not a true protein
  7. 2461021Species Francisella tularensis [TaxId:177416] [189492] (1 PDB entry)
  8. 2461024Domain d3p2lc_: 3p2l C: [183474]
    automated match to d1tyfa_
    complexed with edo, gol, mg, peg, po4

Details for d3p2lc_

PDB Entry: 3p2l (more details), 2.29 Å

PDB Description: Crystal Structure of ATP-dependent Clp protease subunit P from Francisella tularensis
PDB Compounds: (C:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d3p2lc_:

Sequence, based on SEQRES records: (download)

>d3p2lc_ c.14.1.1 (C:) automated matches {Francisella tularensis [TaxId: 177416]}
vptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfy
inspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimih
qplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakay
glidhviesreai

Sequence, based on observed residues (ATOM records): (download)

>d3p2lc_ c.14.1.1 (C:) automated matches {Francisella tularensis [TaxId: 177416]}
vptvfdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyinspggmvta
gmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqplggfrgqa
sdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakayglidhviesr
eai

SCOPe Domain Coordinates for d3p2lc_:

Click to download the PDB-style file with coordinates for d3p2lc_.
(The format of our PDB-style files is described here.)

Timeline for d3p2lc_: