Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) |
Protein automated matches [190231] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189528] (4 PDB entries) |
Domain d3p1mf_: 3p1m F: [183459] automated match to d1e6eb_ complexed with fes, flc, gol, k |
PDB Entry: 3p1m (more details), 2.54 Å
SCOPe Domain Sequences for d3p1mf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p1mf_ d.15.4.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]} edkitvhfinrdgetlttkgkvgdslldvvvennldidgfgacegtlacstchlifedhi yekldaitdeendmldlaygltdrsrlgcqicltksmdnmtvrvpetvadarqsidvgkt saenlyfq
Timeline for d3p1mf_: