Lineage for d3p1mf_ (3p1m F:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1018449Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1018450Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 1018558Protein automated matches [190231] (6 species)
    not a true protein
  7. 1018570Species Human (Homo sapiens) [TaxId:9606] [189528] (4 PDB entries)
  8. 1018582Domain d3p1mf_: 3p1m F: [183459]
    automated match to d1e6eb_
    complexed with fes, flc, gol, k

Details for d3p1mf_

PDB Entry: 3p1m (more details), 2.54 Å

PDB Description: Crystal structure of human ferredoxin-1 (FDX1) in complex with iron-sulfur cluster
PDB Compounds: (F:) Adrenodoxin, mitochondrial

SCOPe Domain Sequences for d3p1mf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p1mf_ d.15.4.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
edkitvhfinrdgetlttkgkvgdslldvvvennldidgfgacegtlacstchlifedhi
yekldaitdeendmldlaygltdrsrlgcqicltksmdnmtvrvpetvadarqsidvgkt
saenlyfq

SCOPe Domain Coordinates for d3p1mf_:

Click to download the PDB-style file with coordinates for d3p1mf_.
(The format of our PDB-style files is described here.)

Timeline for d3p1mf_: