Lineage for d3p1md_ (3p1m D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1403183Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1403184Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 1403307Protein automated matches [190231] (7 species)
    not a true protein
  7. 1403320Species Human (Homo sapiens) [TaxId:9606] [189528] (5 PDB entries)
  8. 1403330Domain d3p1md_: 3p1m D: [183457]
    automated match to d1e6eb_
    complexed with fes, flc, gol, k

Details for d3p1md_

PDB Entry: 3p1m (more details), 2.54 Å

PDB Description: Crystal structure of human ferredoxin-1 (FDX1) in complex with iron-sulfur cluster
PDB Compounds: (D:) Adrenodoxin, mitochondrial

SCOPe Domain Sequences for d3p1md_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p1md_ d.15.4.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dkitvhfinrdgetlttkgkvgdslldvvvennldidgfgacegtlacstchlifedhiy
ekldaitdeendmldlaygltdrsrlgcqicltksmdnmtvrvpetvadarqsidvgkts
aenlyfq

SCOPe Domain Coordinates for d3p1md_:

Click to download the PDB-style file with coordinates for d3p1md_.
(The format of our PDB-style files is described here.)

Timeline for d3p1md_: