![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) |
![]() | Protein automated matches [190231] (14 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189528] (5 PDB entries) |
![]() | Domain d3p1md1: 3p1m D:65-184 [183457] Other proteins in same PDB: d3p1ma2, d3p1mb2, d3p1mc2, d3p1md2, d3p1me2, d3p1mf2, d3p1mg2, d3p1mh2 automated match to d1e6eb_ complexed with fes, flc, gol, k |
PDB Entry: 3p1m (more details), 2.54 Å
SCOPe Domain Sequences for d3p1md1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p1md1 d.15.4.1 (D:65-184) automated matches {Human (Homo sapiens) [TaxId: 9606]} dkitvhfinrdgetlttkgkvgdslldvvvennldidgfgacegtlacstchlifedhiy ekldaitdeendmldlaygltdrsrlgcqicltksmdnmtvrvpetvadarqsidvgkts
Timeline for d3p1md1: