SCOPe 2.02: Domain d3p1fb_: 3p1f B:

Lineage for d3p1fb_ (3p1f B:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (5 proteins)

6. Protein automated matches [190366] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187201] (9 PDB entries)

8. Domain d3p1fb_: 3p1f B: [183452]
   automated match to d1jspb_
   complexed with 3pf, edo, k

Details for d3p1fb_

PDB Entry: 3p1f, 1.63 Å

PDB Description: crystal structure of the bromodomain of human crebbp in complex with a hydroquinazolin ligand

PDB Compounds: (B:) creb-binding protein

SCOPe Domain Sequences for d3p1fb_:

Sequence; same for both SEQRES and ATOM records:

>d3p1fb_ a.29.2.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkl
dtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

Timeline for d3p1fb_:

• d3p1fb_ first appeared in SCOPe 2.01
  
• d3p1fb_ appears in SCOPe 2.03
  
• d3p1fb_ appears in the current release, SCOPe 2.08