| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (3 families) ![]() duplication: consists of two domains of this fold |
| Family a.74.1.1: Cyclin [47955] (8 proteins) |
| Protein Cyclin A [47956] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47957] (35 PDB entries) Uniprot P20248 175-432 |
| Domain d1find2: 1fin D:310-432 [18345] Other proteins in same PDB: d1fina_, d1finc_ complexed with atp |
PDB Entry: 1fin (more details), 2.3 Å
SCOPe Domain Sequences for d1find2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1find2 a.74.1.1 (D:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl
Timeline for d1find2:
View in 3DDomains from other chains: (mouse over for more information) d1fina_, d1finb1, d1finb2, d1finc_ |