Lineage for d3p1ea_ (3p1e A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731436Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1731437Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1731438Family a.29.2.1: Bromodomain [47371] (5 proteins)
  6. 1731470Protein automated matches [190366] (1 species)
    not a true protein
  7. 1731471Species Human (Homo sapiens) [TaxId:9606] [187201] (31 PDB entries)
  8. 1731482Domain d3p1ea_: 3p1e A: [183449]
    automated match to d1jspb_
    complexed with dms, k, scn

Details for d3p1ea_

PDB Entry: 3p1e (more details), 1.8 Å

PDB Description: crystal structure of the bromodomain of human crebbp in complex with dimethyl sulfoxide (dmso)
PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d3p1ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p1ea_ a.29.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkl
dtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl

SCOPe Domain Coordinates for d3p1ea_:

Click to download the PDB-style file with coordinates for d3p1ea_.
(The format of our PDB-style files is described here.)

Timeline for d3p1ea_: