| Class a: All alpha proteins [46456] (202 folds) |
| Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (3 families) ![]() duplication: consists of two domains of this fold |
| Family a.74.1.1: Cyclin [47955] (4 proteins) |
| Protein Cyclin A [47956] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47957] (24 PDB entries) |
| Domain d1qmzd1: 1qmz D:175-309 [18340] Other proteins in same PDB: d1qmza_, d1qmzc_ |
PDB Entry: 1qmz (more details), 2.2 Å
SCOP Domain Sequences for d1qmzd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qmzd1 a.74.1.1 (D:175-309) Cyclin A {Human (Homo sapiens)}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaap
Timeline for d1qmzd1:
View in 3DDomains from other chains: (mouse over for more information) d1qmza_, d1qmzb1, d1qmzb2, d1qmzc_ |