SCOPe 2.01: Domain d1qmzb1: 1qmz B:175-309

Lineage for d1qmzb1 (1qmz B:175-309)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (8 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (35 PDB entries)
   Uniprot P20248 175-432

8. Domain d1qmzb1: 1qmz B:175-309 [18338]
   Other proteins in same PDB: d1qmza_, d1qmzc_
   complexed with atp, mg

Details for d1qmzb1

PDB Entry: 1qmz, 2.2 Å

PDB Description: phosphorylated cdk2-cyclyin a-substrate peptide complex

PDB Compounds: (B:) g2/mitotic-specific cyclin a

SCOPe Domain Sequences for d1qmzb1:

Sequence; same for both SEQRES and ATOM records:

>d1qmzb1 a.74.1.1 (B:175-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaap

Timeline for d1qmzb1:

• d1qmzb1 first appeared (with stable ids) in SCOP 1.55
  
• d1qmzb1 appears in SCOP 1.75
  
• d1qmzb1 appears in SCOPe 2.02
  
• d1qmzb1 appears in the current release, SCOPe 2.08