Lineage for d1jsub2 (1jsu B:310-432)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 357700Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 357701Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 357702Family a.74.1.1: Cyclin [47955] (4 proteins)
  6. 357707Protein Cyclin A [47956] (2 species)
  7. 357711Species Human (Homo sapiens) [TaxId:9606] [47957] (24 PDB entries)
  8. 357729Domain d1jsub2: 1jsu B:310-432 [18337]
    Other proteins in same PDB: d1jsua_, d1jsuc_
    complexed with so4; mutant

Details for d1jsub2

PDB Entry: 1jsu (more details), 2.3 Å

PDB Description: p27(kip1)/cyclin a/cdk2 complex

SCOP Domain Sequences for d1jsub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jsub2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens)}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

SCOP Domain Coordinates for d1jsub2:

Click to download the PDB-style file with coordinates for d1jsub2.
(The format of our PDB-style files is described here.)

Timeline for d1jsub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jsub1