![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
![]() | Superfamily b.84.3: Duplicated hybrid motif [51261] (2 families) ![]() half-barrel sheet of 8 strands sandwiched with two 3-stranded sheets |
![]() | Family b.84.3.1: Glucose permease-like [51262] (3 proteins) |
![]() | Protein automated matches [191300] (1 species) not a true protein |
![]() | Species Vibrio vulnificus [TaxId:216895] [189977] (1 PDB entry) |
![]() | Domain d3ourf_: 3our F: [183306] automated match to d1glaf_ |
PDB Entry: 3our (more details), 2.2 Å
SCOPe Domain Sequences for d3ourf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ourf_ b.84.3.1 (F:) automated matches {Vibrio vulnificus [TaxId: 216895]} aieiiaplsgeivniedvpdvvfaekivgdgiaikptgnkmvapvngtigkifetnhafs iesddgvelfvhfgidtvelkgegftriaeegqtvkagdtviefdlalleekakstltpv visnmdeikelnklsgsvvvgetpvlrvtk
Timeline for d3ourf_: