![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
![]() | Protein automated matches [190069] (309 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:158878] [189493] (1 PDB entry) |
![]() | Domain d3osua_: 3osu A: [183271] automated match to d1q7ba_ complexed with mg, peg, po4 |
PDB Entry: 3osu (more details), 1.9 Å
SCOPe Domain Sequences for d3osua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3osua_ c.2.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158878]} mkmtksalvtgasrgigrsialqlaeegynvavnyagskekaeavveeikakgvdsfaiq anvadadevkamikevvsqfgsldvlvnnagitrdnllmrmkeqewddvidtnlkgvfnc iqkatpqmlrqrsgaiinlssvvgavgnpgqanyvatkagvigltksaarelasrgitvn avapgfivsdmtdalsdelkeqmltqiplarfgqdtdiantvaflasdkakyitgqtihv nggmym
Timeline for d3osua_: