Lineage for d3osua_ (3osu A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2456918Species Staphylococcus aureus [TaxId:158878] [189493] (1 PDB entry)
  8. 2456919Domain d3osua_: 3osu A: [183271]
    automated match to d1q7ba_
    complexed with mg, peg, po4

Details for d3osua_

PDB Entry: 3osu (more details), 1.9 Å

PDB Description: crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] reductase

SCOPe Domain Sequences for d3osua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3osua_ c.2.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158878]}
mkmtksalvtgasrgigrsialqlaeegynvavnyagskekaeavveeikakgvdsfaiq
anvadadevkamikevvsqfgsldvlvnnagitrdnllmrmkeqewddvidtnlkgvfnc
iqkatpqmlrqrsgaiinlssvvgavgnpgqanyvatkagvigltksaarelasrgitvn
avapgfivsdmtdalsdelkeqmltqiplarfgqdtdiantvaflasdkakyitgqtihv
nggmym

SCOPe Domain Coordinates for d3osua_:

Click to download the PDB-style file with coordinates for d3osua_.
(The format of our PDB-style files is described here.)

Timeline for d3osua_: