Lineage for d3oqfa_ (3oqf A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2067626Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2067627Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2069061Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2069552Protein Chymosin (synonym: renin) [50667] (3 species)
  7. 2069560Species Human (Homo sapiens) [TaxId:9606] [50669] (76 PDB entries)
  8. 2069628Domain d3oqfa_: 3oqf A: [183236]
    automated match to d1bila_
    complexed with nag, s51

Details for d3oqfa_

PDB Entry: 3oqf (more details), 2.78 Å

PDB Description: crystal structure analysis of renin-indole-piperazine inhibitor complexes
PDB Compounds: (A:) renin

SCOPe Domain Sequences for d3oqfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oqfa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]}
gnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhkl
fdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlae
fdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlggsdp
qhyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklm
ealgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaiham
dippptgptwalgatfirkfytefdrrnnrigfalar

SCOPe Domain Coordinates for d3oqfa_:

Click to download the PDB-style file with coordinates for d3oqfa_.
(The format of our PDB-style files is described here.)

Timeline for d3oqfa_: