Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) |
Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (2 proteins) automatically mapped to Pfam PF00731 |
Protein automated matches [191111] (4 species) not a true protein |
Species Francisella tularensis [TaxId:119856] [189466] (2 PDB entries) |
Domain d3opqh_: 3opq H: [183230] automated match to d1xmpc_ complexed with cl, f6r, fmt, po4 |
PDB Entry: 3opq (more details), 2 Å
SCOPe Domain Sequences for d3opqh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3opqh_ c.23.8.1 (H:) automated matches {Francisella tularensis [TaxId: 119856]} svqvgvimgsksdwstmkeccdildnlgigyecevvsahrtpdkmfdyaetakerglkvi iagaggaahlpgmvaakttlpvlgvpvksstlngqdsllsivqmpagipvatfaigmaga knaalfaasilqhtdiniakalaefraeqtrfvlenpdpre
Timeline for d3opqh_: