Lineage for d3oowg_ (3oow G:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2465445Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) (S)
  5. 2465446Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (2 proteins)
    automatically mapped to Pfam PF00731
  6. 2465496Protein automated matches [191111] (4 species)
    not a true protein
  7. 2465534Species Francisella tularensis [TaxId:119856] [189466] (2 PDB entries)
  8. 2465541Domain d3oowg_: 3oow G: [183215]
    automated match to d1xmpc_
    complexed with cl, fmt, mpd, po4

Details for d3oowg_

PDB Entry: 3oow (more details), 1.75 Å

PDB Description: octameric structure of the phosphoribosylaminoimidazole carboxylase catalytic subunit from francisella tularensis subsp. tularensis schu s4.
PDB Compounds: (G:) Phosphoribosylaminoimidazole carboxylase,catalytic subunit

SCOPe Domain Sequences for d3oowg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oowg_ c.23.8.1 (G:) automated matches {Francisella tularensis [TaxId: 119856]}
svqvgvimgsksdwstmkeccdildnlgigyecevvsahrtpdkmfdyaetakerglkvi
iagaggaahlpgmvaakttlpvlgvpvksstlngqdsllsivqmpagipvatfaigmaga
knaalfaasilqhtdiniakalaefraeqtrfvlenpdp

SCOPe Domain Coordinates for d3oowg_:

Click to download the PDB-style file with coordinates for d3oowg_.
(The format of our PDB-style files is described here.)

Timeline for d3oowg_: