Lineage for d1ak4c_ (1ak4 C:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 154307Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
  4. 154308Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (1 family) (S)
  5. 154309Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (4 proteins)
  6. 154315Protein HIV-1 capsid protein [47945] (1 species)
  7. 154316Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (8 PDB entries)
  8. 154317Domain d1ak4c_: 1ak4 C: [18321]
    Other proteins in same PDB: d1ak4a_, d1ak4b_

Details for d1ak4c_

PDB Entry: 1ak4 (more details), 2.36 Å

PDB Description: human cyclophilin a bound to the amino-terminal domain of hiv-1 capsid

SCOP Domain Sequences for d1ak4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ak4c_ a.73.1.1 (C:) HIV-1 capsid protein {Human immunodeficiency virus type 1}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmy

SCOP Domain Coordinates for d1ak4c_:

Click to download the PDB-style file with coordinates for d1ak4c_.
(The format of our PDB-style files is described here.)

Timeline for d1ak4c_: