Lineage for d1mabb1 (1mab B:358-477)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 49089Fold a.69: Left-handed superhelix [47916] (2 superfamilies)
  4. 49090Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 49091Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein)
  6. 49092Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (4 species)
  7. 49151Species Rat (Rattus norvegicus) [TaxId:10116] [47921] (1 PDB entry)
  8. 49153Domain d1mabb1: 1mab B:358-477 [18312]
    Other proteins in same PDB: d1maba2, d1maba3, d1mabb2, d1mabb3, d1mabg_

Details for d1mabb1

PDB Entry: 1mab (more details), 2.8 Å

PDB Description: rat liver f1-atpase

SCOP Domain Sequences for d1mabb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mabb1 a.69.1.1 (B:358-477) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Rat (Rattus norvegicus)}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghmgklvplketikgfqqilagdydhlpeqafymvgpieeavakadklaeeh

SCOP Domain Coordinates for d1mabb1:

Click to download the PDB-style file with coordinates for d1mabb1.
(The format of our PDB-style files is described here.)

Timeline for d1mabb1: