Class a: All alpha proteins [46456] (144 folds) |
Fold a.69: Left-handed superhelix [47916] (2 superfamilies) |
Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) |
Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein) |
Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (4 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [47921] (1 PDB entry) |
Domain d1mabb1: 1mab B:358-477 [18312] Other proteins in same PDB: d1maba2, d1maba3, d1mabb2, d1mabb3, d1mabg_ |
PDB Entry: 1mab (more details), 2.8 Å
SCOP Domain Sequences for d1mabb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mabb1 a.69.1.1 (B:358-477) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Rat (Rattus norvegicus)} mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp fqvaevftghmgklvplketikgfqqilagdydhlpeqafymvgpieeavakadklaeeh
Timeline for d1mabb1:
View in 3D Domains from other chains: (mouse over for more information) d1maba1, d1maba2, d1maba3, d1mabg_ |