![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
![]() | Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) ![]() |
![]() | Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins) |
![]() | Protein F1 ATP synthase beta subunit, domain 3 [88928] (5 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [88930] (1 PDB entry) |
![]() | Domain d1mabb1: 1mab B:358-477 [18312] Other proteins in same PDB: d1maba1, d1maba2, d1maba3, d1mabb2, d1mabb3, d1mabg_ complexed with adp, atp, mg, po4 |
PDB Entry: 1mab (more details), 2.8 Å
SCOPe Domain Sequences for d1mabb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mabb1 a.69.1.1 (B:358-477) F1 ATP synthase beta subunit, domain 3 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp fqvaevftghmgklvplketikgfqqilagdydhlpeqafymvgpieeavakadklaeeh
Timeline for d1mabb1:
![]() Domains from other chains: (mouse over for more information) d1maba1, d1maba2, d1maba3, d1mabg_ |