Lineage for d3ol6i_ (3ol6 I:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1951566Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1951567Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1952391Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. 1952399Protein Viral RNA polymerase [56695] (17 species)
  7. 1952655Species Poliovirus type 1, strain Mahoney [TaxId:12080] [56696] (12 PDB entries)
    Uniprot P03300 1748-2208
  8. 1952671Domain d3ol6i_: 3ol6 I: [183112]
    automated match to d1ra6a_
    protein/RNA complex; complexed with ipa, zn

Details for d3ol6i_

PDB Entry: 3ol6 (more details), 2.5 Å

PDB Description: poliovirus polymerase elongation complex
PDB Compounds: (I:) Polymerase

SCOPe Domain Sequences for d3ol6i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ol6i_ e.8.1.4 (I:) Viral RNA polymerase {Poliovirus type 1, strain Mahoney [TaxId: 12080]}
geiqwmrpskevgypiinapsktklepsafhyvfegvkepavltkndprlktdfeeaifs
kyvgnkitevdeymkeavdhyagqlmsldinteqmcledamygtdglealdlstsagypy
vamgkkkrdilnkqtrdtkemqklldtyginlplvtyvkdelrsktkveqgksrlieass
lndsvamrmafgnlyaafhknpgvitgsavgcdpdlfwskipvlmeeklfafdytgydas
lspawfealkmvlekigfgdrvdyidylnhshhlyknktycvkggmpsgcsgtsifnsmi
nnliirtlllktykgidldhlkmiaygddviasyphevdasllaqsgkdygltmtpadks
atfetvtwenvtflkrffradekypflihpvmpmkeihesirwtkdprntqdhvrslcll
awhngeeeynkflakirsvpigraldlpeystlyrrwldsf

SCOPe Domain Coordinates for d3ol6i_:

Click to download the PDB-style file with coordinates for d3ol6i_.
(The format of our PDB-style files is described here.)

Timeline for d3ol6i_: