Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins) |
Protein Viral RNA polymerase [56695] (17 species) |
Species Poliovirus type 1, strain Mahoney [TaxId:12080] [56696] (12 PDB entries) Uniprot P03300 1748-2208 |
Domain d3ol6i_: 3ol6 I: [183112] automated match to d1ra6a_ protein/RNA complex; complexed with ipa, zn |
PDB Entry: 3ol6 (more details), 2.5 Å
SCOPe Domain Sequences for d3ol6i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ol6i_ e.8.1.4 (I:) Viral RNA polymerase {Poliovirus type 1, strain Mahoney [TaxId: 12080]} geiqwmrpskevgypiinapsktklepsafhyvfegvkepavltkndprlktdfeeaifs kyvgnkitevdeymkeavdhyagqlmsldinteqmcledamygtdglealdlstsagypy vamgkkkrdilnkqtrdtkemqklldtyginlplvtyvkdelrsktkveqgksrlieass lndsvamrmafgnlyaafhknpgvitgsavgcdpdlfwskipvlmeeklfafdytgydas lspawfealkmvlekigfgdrvdyidylnhshhlyknktycvkggmpsgcsgtsifnsmi nnliirtlllktykgidldhlkmiaygddviasyphevdasllaqsgkdygltmtpadks atfetvtwenvtflkrffradekypflihpvmpmkeihesirwtkdprntqdhvrslcll awhngeeeynkflakirsvpigraldlpeystlyrrwldsf
Timeline for d3ol6i_: