Lineage for d3okjq_ (3okj Q:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437613Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1437614Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1437785Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1437897Protein Proteasome alpha subunit (non-catalytic) [56255] (6 species)
    contains an extension to the common fold at the N-terminus
  7. 1437913Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (45 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1438130Domain d3okjq_: 3okj Q: [183094]
    Other proteins in same PDB: d3okj1_, d3okj2_, d3okjd_, d3okjg_, d3okjh_, d3okji_, d3okjj_, d3okjk_, d3okjl_, d3okjm_, d3okjn_, d3okjr_, d3okju_, d3okjv_, d3okjw_, d3okjx_, d3okjy_, d3okjz_
    automated match to d1g65c_
    complexed with ep9

Details for d3okjq_

PDB Entry: 3okj (more details), 2.7 Å

PDB Description: alpha-keto-aldehyde binding mechanism reveals a novel lead structure motif for proteasome inhibition
PDB Compounds: (Q:) Proteasome component PRE6

SCOPe Domain Sequences for d3okjq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3okjq_ d.153.1.4 (Q:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
q

SCOPe Domain Coordinates for d3okjq_:

Click to download the PDB-style file with coordinates for d3okjq_.
(The format of our PDB-style files is described here.)

Timeline for d3okjq_: