Lineage for d3okj2_ (3okj 2:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437613Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1437614Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1437785Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1438333Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1438342Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (50 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1438733Domain d3okj2_: 3okj 2: [183078]
    Other proteins in same PDB: d3okja_, d3okjb_, d3okjc_, d3okje_, d3okjf_, d3okjg_, d3okjo_, d3okjp_, d3okjq_, d3okjs_, d3okjt_, d3okju_
    automated match to d1g0u2_
    complexed with ep9

Details for d3okj2_

PDB Entry: 3okj (more details), 2.7 Å

PDB Description: alpha-keto-aldehyde binding mechanism reveals a novel lead structure motif for proteasome inhibition
PDB Compounds: (2:) Proteasome component PRE3

SCOPe Domain Sequences for d3okj2_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3okj2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
agverlifypdeyeql

SCOPe Domain Coordinates for d3okj2_:

Click to download the PDB-style file with coordinates for d3okj2_.
(The format of our PDB-style files is described here.)

Timeline for d3okj2_: