Lineage for d3ohva1 (3ohv A:9-129)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2945442Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2945443Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2945784Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 2945785Protein automated matches [190710] (5 species)
    not a true protein
  7. 2945786Species Human (Homo sapiens) [TaxId:9606] [187857] (54 PDB entries)
  8. 2945820Domain d3ohva1: 3ohv A:9-129 [183041]
    Other proteins in same PDB: d3ohva2
    automated match to d1r28a_

Details for d3ohva1

PDB Entry: 3ohv (more details), 2.2 Å

PDB Description: Crystal structure of the human Bach2 POZ domain, form II
PDB Compounds: (A:) Transcription regulator protein BACH2

SCOPe Domain Sequences for d3ohva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ohva1 d.42.1.0 (A:9-129) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spmyvyestvhctnillglndqrkkdilcdvtliverkefrahravlaacseyfwqalvg
qtkndlvvslpeevtargfgpllqfaytaklllsrenirevircaeflrmhnledscfsf
l

SCOPe Domain Coordinates for d3ohva1:

Click to download the PDB-style file with coordinates for d3ohva1.
(The format of our PDB-style files is described here.)

Timeline for d3ohva1: