SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3ohua1 (3ohu A:9-129)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2169177Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2169178Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2169402Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 2169403Protein automated matches [190710] (3 species)
    not a true protein
  7. 2169404Species Human (Homo sapiens) [TaxId:9606] [187857] (36 PDB entries)
  8. 2169424Domain d3ohua1: 3ohu A:9-129 [183035]
    Other proteins in same PDB: d3ohua2
    automated match to d1r28a_

Details for d3ohua1

PDB Entry: 3ohu (more details), 2.1 Å

PDB Description: Crystal structure of the human Bach2 POZ domain, form I
PDB Compounds: (A:) Transcription regulator protein BACH2

SCOPe Domain Sequences for d3ohua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ohua1 d.42.1.0 (A:9-129) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spmyvyestvhctnillglndqrkkdilcdvtliverkefrahravlaacseyfwqalvg
qtkndlvvslpeevtargfgpllqfaytaklllsrenirevircaeflrmhnledscfsf
l

SCOPe Domain Coordinates for d3ohua1:

Click to download the PDB-style file with coordinates for d3ohua1.
(The format of our PDB-style files is described here.)

Timeline for d3ohua1: