Lineage for d3oeig_ (3oei G:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2242143Fold d.298: RelE-like [143010] (1 superfamily)
    beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432
  4. 2242144Superfamily d.298.1: RelE-like [143011] (3 families) (S)
    Toxin component of plasmid stabilisation system
  5. 2242176Family d.298.1.0: automated matches [191658] (1 protein)
    not a true family
  6. 2242177Protein automated matches [191236] (5 species)
    not a true protein
  7. 2242205Species Mycobacterium tuberculosis [TaxId:1773] [189667] (1 PDB entry)
  8. 2242208Domain d3oeig_: 3oei G: [182962]
    Other proteins in same PDB: d3oeia_, d3oeib_, d3oeic2, d3oeid2, d3oeie_, d3oeif_, d3oeih2, d3oeii_, d3oeij_, d3oeim_, d3oein_
    automated match to d2a6qe1
    complexed with flc

Details for d3oeig_

PDB Entry: 3oei (more details), 2.15 Å

PDB Description: crystal structure of mycobacterium tuberculosis reljk (rv3357-rv3358- relbe3)
PDB Compounds: (G:) RelK (Toxin Rv3358)

SCOPe Domain Sequences for d3oeig_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oeig_ d.298.1.0 (G:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
svnfdpdawedflfwlaadrktarritrligeiqrdpfsgigkpeplqgelsgywsrrid
dehrlvyragddevtmlkaryhy

SCOPe Domain Coordinates for d3oeig_:

Click to download the PDB-style file with coordinates for d3oeig_.
(The format of our PDB-style files is described here.)

Timeline for d3oeig_: