Lineage for d3oeid1 (3oei D:2-85)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2615958Fold d.298: RelE-like [143010] (1 superfamily)
    beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432
  4. 2615959Superfamily d.298.1: RelE-like [143011] (3 families) (S)
    Toxin component of plasmid stabilisation system
  5. 2615995Family d.298.1.0: automated matches [191658] (1 protein)
    not a true family
  6. 2615996Protein automated matches [191236] (7 species)
    not a true protein
  7. 2616024Species Mycobacterium tuberculosis [TaxId:1773] [189667] (1 PDB entry)
  8. 2616026Domain d3oeid1: 3oei D:2-85 [182961]
    Other proteins in same PDB: d3oeia_, d3oeib_, d3oeic2, d3oeid2, d3oeie_, d3oeif_, d3oeih2, d3oeii_, d3oeij_, d3oeim_, d3oein_
    automated match to d2a6qe1
    complexed with flc

Details for d3oeid1

PDB Entry: 3oei (more details), 2.15 Å

PDB Description: crystal structure of mycobacterium tuberculosis reljk (rv3357-rv3358- relbe3)
PDB Compounds: (D:) RelK (Toxin Rv3358)

SCOPe Domain Sequences for d3oeid1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oeid1 d.298.1.0 (D:2-85) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
rsvnfdpdawedflfwlaadrktarritrligeiqrdpfsgigkpeplqgelsgywsrri
ddehrlvyragddevtmlkaryhy

SCOPe Domain Coordinates for d3oeid1:

Click to download the PDB-style file with coordinates for d3oeid1.
(The format of our PDB-style files is described here.)

Timeline for d3oeid1: