| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.298: RelE-like [143010] (1 superfamily) beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432 |
Superfamily d.298.1: RelE-like [143011] (3 families) ![]() Toxin component of plasmid stabilisation system |
| Family d.298.1.0: automated matches [191658] (1 protein) not a true family |
| Protein automated matches [191236] (7 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:1773] [189667] (1 PDB entry) |
| Domain d3oeid1: 3oei D:2-85 [182961] Other proteins in same PDB: d3oeia_, d3oeib_, d3oeic2, d3oeid2, d3oeie_, d3oeif_, d3oeih2, d3oeii_, d3oeij_, d3oeim_, d3oein_ automated match to d2a6qe1 complexed with flc |
PDB Entry: 3oei (more details), 2.15 Å
SCOPe Domain Sequences for d3oeid1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oeid1 d.298.1.0 (D:2-85) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
rsvnfdpdawedflfwlaadrktarritrligeiqrdpfsgigkpeplqgelsgywsrri
ddehrlvyragddevtmlkaryhy
Timeline for d3oeid1: