SCOPe 2.08: Domain d3odba_: 3odb A:

Lineage for d3odba_ (3odb A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Ferric-binding protein FbpA [53867] (7 species)

7. Species Haemophilus influenzae [TaxId:727] [53868] (12 PDB entries)

8. Domain d3odba_: 3odb A: [182947]
   automated match to d1d9va_
   complexed with fe
   has additional insertions and/or extensions that are not grouped together

Details for d3odba_

PDB Entry: 3odb, 1.62 Å

PDB Description: Haemophilus influenzae ferric binding protein A -Iron Loaded -open Conformation

PDB Compounds: (A:) Iron-utilization periplasmic protein

SCOPe Domain Sequences for d3odba_:

Sequence; same for both SEQRES and ATOM records:

>d3odba_ c.94.1.1 (A:) Ferric-binding protein FbpA {Haemophilus influenzae [TaxId: 727]}
ditvyngqhkeaatavakafeqetgikvtlnsgkseqlagqlkeegdktpadvfyteqta
tfadlseagllapiseqtiqqtaqkgvplapkkdwialsgrsrvvvydhtklsekdmeks
vldyatpkwkgkigyvstsgafleqvvalskmkgdkvalnwlkglkengklyaknsvalq
avengevpaalinnyywynlakekgvenlksrlyfvrhqdpgalvsysgaavlkasknqa
eaqkfvdflaskkgqealvaaraeyplradvvspfnlepyekleapvvsattaqdkehai
klieeagl

Timeline for d3odba_:

• d3odba_ first appeared in SCOPe 2.01
  
• d3odba_ appears in SCOPe 2.07