Lineage for d3obsa_ (3obs A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1642804Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1642805Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1643094Family d.20.1.2: UEV domain [75383] (3 proteins)
  6. 1643113Protein automated matches [191205] (2 species)
    not a true protein
  7. 1643117Species Human (Homo sapiens) [TaxId:9606] [189548] (1 PDB entry)
  8. 1643118Domain d3obsa_: 3obs A: [182922]
    automated match to d1kppa_

Details for d3obsa_

PDB Entry: 3obs (more details), 1.5 Å

PDB Description: Crystal structure of Tsg101 UEV domain
PDB Compounds: (A:) Tumor susceptibility gene 101 protein

SCOPe Domain Sequences for d3obsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3obsa_ d.20.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
savsesqlkkmvskykyrdltvretvnvitlykdlkpvldsygtgsrelmnltgtipvpy
rgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqsd
llgliqvmivvfgdeppvfs

SCOPe Domain Coordinates for d3obsa_:

Click to download the PDB-style file with coordinates for d3obsa_.
(The format of our PDB-style files is described here.)

Timeline for d3obsa_: