| Class b: All beta proteins [48724] (178 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.13: Chromo domain-like [54160] (4 families) ![]() SH3-like barrel is capped by a C-terminal helix |
| Family b.34.13.0: automated matches [191621] (1 protein) not a true family |
| Protein automated matches [191139] (6 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189257] (7 PDB entries) |
| Domain d3ob9a_: 3ob9 A: [182909] Other proteins in same PDB: d3ob9d2 automated match to d2efia1 complexed with nhe, so4 |
PDB Entry: 3ob9 (more details), 2.5 Å
SCOPe Domain Sequences for d3ob9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ob9a_ b.34.13.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
egmkfkfhsgekvlcfepdptkarvlydakivdvivgkdekgrkipeylihfngwnrswd
rwaaedhvlrdtdenrrlqrklarkavar
Timeline for d3ob9a_: