SCOPe 2.01: Domain d3o73b_: 3o73 B:

Lineage for d3o73b_ (3o73 B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.3: Quinone reductase [52235] (4 proteins)
   binds FAD

6. Protein Quinone reductase type 2 (menadione reductase) [52240] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52241] (38 PDB entries)

8. Domain d3o73b_: 3o73 B: [182852]
   automated match to d1qr2a_
   complexed with fad, o73, zn

Details for d3o73b_

PDB Entry: 3o73, 2 Å

PDB Description: Crystal structure of quinone reductase 2 in complex with the indolequinone MAC627

PDB Compounds: (B:) Ribosyldihydronicotinamide dehydrogenase [quinone]

SCOPe Domain Sequences for d3o73b_:

Sequence; same for both SEQRES and ATOM records:

>d3o73b_ c.23.5.3 (B:) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]}
agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq

Timeline for d3o73b_:

• d3o73b_ is new in SCOPe 2.01-stable
  
• d3o73b_ appears in SCOPe 2.02
  
• d3o73b_ appears in the current release, SCOPe 2.08