Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein MAP kinase Erk2 [56134] (2 species) CMGC group; ERK/MAPK subfamily; serine/threonine kinase |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [56136] (36 PDB entries) |
Domain d3o71a_: 3o71 A: [182850] automated match to d1erka_ complexed with scn |
PDB Entry: 3o71 (more details), 1.95 Å
SCOPe Domain Sequences for d3o71a_:
Sequence, based on SEQRES records: (download)
>d3o71a_ d.144.1.7 (A:) MAP kinase Erk2 {Norway rat (Rattus norvegicus) [TaxId: 10116]} pemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikkispfehqtycqrtlr eikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyfl yqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyvat rwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqe dlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalah pyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqp
>d3o71a_ d.144.1.7 (A:) MAP kinase Erk2 {Norway rat (Rattus norvegicus) [TaxId: 10116]} pemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikkispfehqtycqrtlr eikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyfl yqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpgflteyvatrwyra peimlnsgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqedlncii nlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalahpyleqy ydpsdepiaeapfkfdmelddlpkeklkelifeetarfqp
Timeline for d3o71a_: