Lineage for d3o6tc_ (3o6t C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2487931Species Mycobacterium tuberculosis [TaxId:83332] [189521] (3 PDB entries)
  8. 2487935Domain d3o6tc_: 3o6t C: [182843]
    automated match to d1nw2a_
    complexed with pge, px5; mutant

Details for d3o6tc_

PDB Entry: 3o6t (more details), 2.4 Å

PDB Description: Mycobacterium tuberculosis thioredoxin C C40S mutant in Complex with Quinol Inhibitor PMX464
PDB Compounds: (C:) thioredoxin

SCOPe Domain Sequences for d3o6tc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o6tc_ c.47.1.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
satikvtdasfatdvlssnkpvlvdfwatwcgpskmvapvleeiateratdltvakldvd
tnpetarnfqvvsiptlilfkdgqpvkrivgakgkaallrelsdvvpn

SCOPe Domain Coordinates for d3o6tc_:

Click to download the PDB-style file with coordinates for d3o6tc_.
(The format of our PDB-style files is described here.)

Timeline for d3o6tc_: