Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (188 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [189521] (3 PDB entries) |
Domain d3o6tc_: 3o6t C: [182843] automated match to d1nw2a_ complexed with pge, px5; mutant |
PDB Entry: 3o6t (more details), 2.4 Å
SCOPe Domain Sequences for d3o6tc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o6tc_ c.47.1.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} satikvtdasfatdvlssnkpvlvdfwatwcgpskmvapvleeiateratdltvakldvd tnpetarnfqvvsiptlilfkdgqpvkrivgakgkaallrelsdvvpn
Timeline for d3o6tc_: