Lineage for d3o61c_ (3o61 C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2577867Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2577868Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2577869Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2578055Protein ADP-ribose pyrophosphatase homologue YffH [103201] (1 species)
  7. 2578056Species Escherichia coli [TaxId:562] [103202] (5 PDB entries)
  8. 2578068Domain d3o61c_: 3o61 C: [182821]
    automated match to d1viua_
    complexed with cl, gdd, mg, na

Details for d3o61c_

PDB Entry: 3o61 (more details), 2.45 Å

PDB Description: Structure of the E100A E.coli GDP-mannose hydrolase (yffh) in complex with GDP-mannose and Mg++
PDB Compounds: (C:) GDP-mannose pyrophosphatase nudK

SCOPe Domain Sequences for d3o61c_:

Sequence, based on SEQRES records: (download)

>d3o61c_ d.113.1.1 (C:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]}
tqqitlikdkilsdnyftlhnitydltrkdgevirhkrevydrgngatillyntkkktvv
lirqfrvatwvngnesgqliescaglldndepevcirkaaieetgyevgevrklfelyms
pggvtelihffiaeysdnqranagggvededievlelpfsqalemiktgeirdgktvlll
nylqtshlmd

Sequence, based on observed residues (ATOM records): (download)

>d3o61c_ d.113.1.1 (C:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]}
tqqitlikdkilsdnyftlhnitydltrkdgevirhkrevydrgngatillyntkkktvv
lirqfrvatwvngnesgqliescaglldndepevcirkaaieetgyevgevrklfelyms
pggvtelihffiaeysdnqraedievlelpfsqalemiktgeirdgktvlllnylqtshl
md

SCOPe Domain Coordinates for d3o61c_:

Click to download the PDB-style file with coordinates for d3o61c_.
(The format of our PDB-style files is described here.)

Timeline for d3o61c_: