Lineage for d3o3ha_ (3o3h A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1606596Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1606597Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 1606837Protein automated matches [190266] (7 species)
    not a true protein
  7. 1606861Species Thermotoga maritima [TaxId:2336] [189559] (4 PDB entries)
  8. 1606864Domain d3o3ha_: 3o3h A: [182777]
    automated match to d2etja1
    protein/DNA complex; protein/RNA complex; complexed with mn

Details for d3o3ha_

PDB Entry: 3o3h (more details), 2.8 Å

PDB Description: T. maritima RNase H2 D107N in complex with nucleic acid substrate and manganese ions
PDB Compounds: (A:) ribonuclease hii

SCOPe Domain Sequences for d3o3ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o3ha_ c.55.3.1 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}
gidelykkefgivagvdeagrgclagpvvaaavvlekeiegindskqlspakrerlldei
mekaavgigiaspeeidlynifnatklamnralenlsvkpsfvlvngkgielsvpgtclv
kgdqkskligaasivakvfrdrlmsefhrmypqfsfhkhkgyatkehlneirkngvlpih
rlsfepvlelltddllreffekglisenrferilnllgarks

SCOPe Domain Coordinates for d3o3ha_:

Click to download the PDB-style file with coordinates for d3o3ha_.
(The format of our PDB-style files is described here.)

Timeline for d3o3ha_: