Lineage for d3o23a_ (3o23 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2588271Protein Insulin-like growth factor 1 receptor [69825] (1 species)
    PTK group; InsR subfamily; membrane spanning protein tyrosine kinase
  7. 2588272Species Human (Homo sapiens) [TaxId:9606] [69826] (18 PDB entries)
  8. 2588287Domain d3o23a_: 3o23 A: [182745]
    automated match to d1m7na_
    complexed with mqy

Details for d3o23a_

PDB Entry: 3o23 (more details), 2.1 Å

PDB Description: Human unphosphorylated IGF1-R Kinase domain in complex with an hydantoin inhibitor
PDB Compounds: (A:) insulin-like growth factor 1 receptor

SCOPe Domain Sequences for d3o23a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o23a_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]}
ewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmrerieflne
asvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpemennpvlappsls
kmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdyyrkgg
kgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvmeggl
ldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyse

SCOPe Domain Coordinates for d3o23a_:

Click to download the PDB-style file with coordinates for d3o23a_.
(The format of our PDB-style files is described here.)

Timeline for d3o23a_: