SCOPe 2.01: Domain d3o18b_: 3o18 B:

Lineage for d3o18b_ (3o18 B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore

6. Protein Phycocyanin beta subunit [88940] (7 species)

7. Species Synechococcus vulcanus [TaxId:32053] [88944] (5 PDB entries)

8. Domain d3o18b_: 3o18 B: [182725]
   Other proteins in same PDB: d3o18a_
   automated match to d1i7yb_
   complexed with cyc

Details for d3o18b_

PDB Entry: 3o18, 1.35 Å

PDB Description: Crystal structure of c-phycocyanin from Themosynechococcus vulcanus at 1.35 angstroms resolution

PDB Compounds: (B:) c-phycocyanin beta subunit

SCOPe Domain Sequences for d3o18b_:

Sequence; same for both SEQRES and ATOM records:

>d3o18b_ a.1.1.3 (B:) Phycocyanin beta subunit {Synechococcus vulcanus [TaxId: 32053]}
mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf
aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal
gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava

Timeline for d3o18b_:

• d3o18b_ is new in SCOPe 2.01-stable
  
• d3o18b_ appears in SCOPe 2.02
  
• d3o18b_ appears in the current release, SCOPe 2.08