SCOPe 2.03: Domain d3nyzb_: 3nyz B:

Lineage for d3nyzb_ (3nyz B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)

6. Protein automated matches [190053] (8 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [190005] (6 PDB entries)

8. Domain d3nyzb_: 3nyz B: [182634]
   automated match to d1a53a_
   complexed with so4

Details for d3nyzb_

PDB Entry: 3nyz, 1.51 Å

PDB Description: Crystal Structure of Kemp Elimination Catalyst 1A53-2

PDB Compounds: (B:) indole-3-glycerol phosphate synthase

SCOPe Domain Sequences for d3nyzb_:

Sequence; same for both SEQRES and ATOM records:

>d3nyzb_ c.1.2.4 (B:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
prylkgwlkdvvqlslrrpsfrasrqrpiislnerilefnkrnitaiiaaykrkspsgld
verdpieyskfmeryavglaiateekyfngsyetlrkiassvsipilmwdfivkesqidd
aynlgadtvalivkiltereleslleyarsygmepaivindendldialrigarfieias
rdletleinkenqrklismipsnvvkvawqgiserneieelrklgvnafgigsslmrnpe
kikefil

Timeline for d3nyzb_:

• d3nyzb_ first appeared in SCOPe 2.01
  
• d3nyzb_ appears in SCOPe 2.02
  
• d3nyzb_ appears in SCOPe 2.04
  
• d3nyzb_ appears in the current release, SCOPe 2.08